| Edit |   |
| Antigenic Specificity | C14orf80 |
| Clone | polyclonal |
| Host Species | Rabbit |
| Reactive Species | human, horse, bovine, rat, guinea pig |
| Isotype | n/a |
| Format | affinity purified |
| Size | 50ug |
| Concentration | n/a |
| Applications | WB |
| Reviews / Ratings | If you have used this antibody, please help fellow researchers by submitting reviews to pAbmAbs and antYbuddY. |
| Description | Rabbit polyclonal Anti-C14orf80 Antibody |
| Immunogen | The immunogen for anti-C14orf80 antibody: synthetic peptide directed towards the n terminal of human C14orf80. Synthetic peptide located within the following region: MLAQARVPLGDEMTVCQIHLYTRGCHSDQSLSHLSVTEAEMLRDPEGGQQ |
| Other Names | chromosome 14 open reading frame 80 |
| Gene, Accession # | C14orf80, Accession: NM_001134875 |
| Catalog # | TA331399 |
| Price | |
| Order / More Info | C14orf80 Antibody from ORIGENE TECHNOLOGIES |
| Product Specific References | n/a |