| 产品详情 |
| Edit |   |
|---|
| Antigenic Specificity | IL21, aa40-68 |
|---|
| Clone | polyclonal |
|---|
| Host Species | Goat |
|---|
| Reactive Species | human |
|---|
| Isotype | n/a |
|---|
| Format | affinity purified |
|---|
| Size | n/a |
|---|
| Concentration | n/a |
|---|
| Applications | ELISA (1:100000) |
|---|
| Reviews / Ratings | If you have used this antibody, please help fellow researchers by submitting reviews to pAbmAbs and antYbuddY. |
|---|
| Description | IL21 Antibody (aa40-68) LS-C187848. Recognizes human interleukin-21, also known as IL-21 or Za11. IL-21 is a, a 155 amino acid pro-cytokine, reduced to 133 amino acids in the secreted mature form. IL-21 is a potent immunoregulatory cytokine and member of the IL-15/IL-21 family, expressed and secreted by activated CD4+ T cells. Two potential isoforms are generated by alternative splicing and differing is sequence at the C-terminus. Recognizes an epitope within the N-terminal (NT) region of human interleukin-21 (IL-21) and is expected to bind both isoforms. IL-21 enhances the proliferation/differentiation of stimulated B-cells, the proliferation of bone marrow progenitor cells, and increases the activity of NK cells and disease-specific CD8+ T-cells. IL-21 signals through binding to the specific type I cytokine receptor IL-21R, coupled with the common cytokine receptor g chain (gc), initiating the activation of the JAK/STAT signalling pathway. Is suitable for use in immunocytochemistry on human spleen or tonsil cells. |
|---|
| Immunogen | Synthetic peptide C-RQLIDIVDQLKNYVNDLVPEFLPAPEDVE corresponding to amino acids 40-68 within the N-terminal region of human IL-21. Percent identity by BLAST analysis: Human, Chimpanzee, Gorilla, Orangutan (100%); Gibbon, Monkey, Marmoset (97%); Sheep, Bovine, Horse (93%); Elephant, Dog (90%); Panda, Cat, Pig (83%). |
|---|
| Other Names | IL21, Interleukin 21, Interleukin-21, Interleukin-21 isoform, Za11, IL-21 |
|---|
| Gene, Accession # | IL21, Gene ID: 59067 |
|---|
| Catalog # | LS-C187848 |
|---|
| Price | |
|---|
| Order / More Info | IL21, aa40-68 Antibody from LIFESPAN BIOSCIENCES INC. |
|---|
| Product Specific References | n/a |
|---|
| 产品资料 |
|
|