| 产品详情 |
| Edit |   |
|---|
| Antigenic Specificity | GPR2/CCR10 |
|---|
| Clone | polyclonal |
|---|
| Host Species | Rabbit |
|---|
| Reactive Species | human, mouse, rat |
|---|
| Isotype | n/a |
|---|
| Format | unconjugated |
|---|
| Size | 100ug |
|---|
| Concentration | 0.5-1mg/ml, actual concentration varies by lot. |
|---|
| Applications | IHC-P, WB |
|---|
| Reviews / Ratings | If you have used this antibody, please help fellow researchers by submitting reviews to pAbmAbs and antYbuddY. |
|---|
| Description | Rabbit IgG polyclonal Picoband™ antibody for GPR2/CCR10 detection. Tested with WB, IHC-P in Human;Mouse;Rat. No cross reactivity with other proteins. C-C chemokine receptor type 10 is a protein that in humans is encoded by the CCR10 gene. It is mapped to 17q21.2. Chemokines are a group of small (approximately 8 to 14 kD), mostly basic, structurally related molecules that regulate cell trafficking of various types of leukocytes through interactions with a subset of 7-transmembrane, G protein-coupled receptors. Chemokines also play fundamental roles in the development, homeostasis, and function of the immune system, and they have effects on cells of the central nervous system as well as on endothelial cells involved in angiogenesis or angiostasis. Chemokines are divided into 2 major subfamilies, CXC and CC, based on the arrangement of the first 2 of the 4 conserved cysteine residues; the 2 cysteines are separated by a single amino acid in CXC chemokines and are adjacent in CC chemokines. CCR10 is the receptor for CCL27 (SCYA27; MIM 604833); CCR10-CCL27 interactions are involved in T cell-mediated skin inflammation. |
|---|
| Immunogen | A synthetic peptide corresponding to a sequence of human GPR2/CCR10(TEATEQVSWGHYSGDEEDAYSAEPLPELCYKADVQAFSRAFQ). |
|---|
| Other Names | C-C chemokine receptor type 10; C-C CKR-10; CC-CKR-10; CCR-10; G-protein coupled receptor 2; CCR10; GPR2 |
|---|
| Gene, Accession # | CCR10, UniProt: P46092 |
|---|
| Catalog # | A04731-1 |
|---|
| Price | |
|---|
| Order / More Info | GPR2/CCR10 Antibody from BOSTER BIO |
|---|
| Product Specific References | n/a |
|---|
| 产品资料 |
|
|