| Edit |   |
| Antigenic Specificity | DDX31 |
| Clone | polyclonal |
| Host Species | Rabbit |
| Reactive Species | human, rat, mouse, guinea pig |
| Isotype | n/a |
| Format | affinity purified |
| Size | 100ug |
| Concentration | n/a |
| Applications | WB |
| Reviews / Ratings | If you have used this antibody, please help fellow researchers by submitting reviews to pAbmAbs and antYbuddY. |
| Description | Rabbit Polyclonal Anti-DDX31 Antibody |
| Immunogen | The immunogen for anti-DDX31 antibody: synthetic peptide directed towards the N terminal of human DDX31. Synthetic peptide located within the following region: QASSEAPPAKRRNETSFLPAKKTSVKETQRTFKGNAQKMFSPKKHSVSTS |
| Other Names | PPP1R25, DEAD (Asp-Glu-Ala-Asp) box polypeptide 31 |
| Gene, Accession # | DDX31, Accession: NM_138620 |
| Catalog # | TA341619 |
| Price | |
| Order / More Info | DDX31 Antibody from ORIGENE TECHNOLOGIES |
| Product Specific References | n/a |