| Edit |   |
|---|
| Antigenic Specificity | RAB42 |
|---|
| Clone | polyclonal |
|---|
| Host Species | Rabbit |
|---|
| Reactive Species | human, rabbit, guinea pig, mouse, horse |
|---|
| Isotype | n/a |
|---|
| Format | affinity purified |
|---|
| Size | 50ug |
|---|
| Concentration | n/a |
|---|
| Applications | WB |
|---|
| Reviews / Ratings | If you have used this antibody, please help fellow researchers by submitting reviews to pAbmAbs and antYbuddY. |
|---|
| Description | Rabbit Polyclonal Anti-RAB42 Antibody |
|---|
| Immunogen | The immunogen for Anti-RAB42 Antibody is: synthetic peptide directed towards the C-terminal region of Human RAB42. Synthetic peptide located within the following region: AFDTLADAIQQALQQGDIKLEEGWGGVRLIHKTQIPRSPSRKQHSGPCQC |
|---|
| Other Names | RAB42, member RAS oncogene family |
|---|
| Gene, Accession # | RAB42, Accession: NM_001193532 |
|---|
| Catalog # | TA334069 |
|---|
| Price | |
|---|
| Order / More Info | RAB42 Antibody from ORIGENE TECHNOLOGIES |
|---|
| Product Specific References | n/a |
|---|