| Edit |   |
| Antigenic Specificity | C10orf96 |
| Clone | polyclonal |
| Host Species | Rabbit |
| Reactive Species | human, dog, guinea pig, porcine, rabbit |
| Isotype | n/a |
| Format | affinity purified |
| Size | 50ug |
| Concentration | n/a |
| Applications | WB |
| Reviews / Ratings | If you have used this antibody, please help fellow researchers by submitting reviews to pAbmAbs and antYbuddY. |
| Description | Rabbit Polyclonal Anti-C10orf96 Antibody |
| Immunogen | The immunogen for Anti-C10orf96 Antibody: synthetic peptide directed towards the middle region of human C10orf96. Synthetic peptide located within the following region: QANMLKSEMKSMEHDSSQLNELQKQKSELIQELFTLQRKLKVFEDEENES |
| Other Names | C10orf96, coiled-coil domain containing 172 |
| Gene, Accession # | CCDC172, Accession: NM_198515 |
| Catalog # | TA333360 |
| Price | |
| Order / More Info | C10orf96 Antibody from ORIGENE TECHNOLOGIES |
| Product Specific References | n/a |