| Edit |   |
|---|
| Antigenic Specificity | C11orf53 |
|---|
| Clone | polyclonal |
|---|
| Host Species | Rabbit |
|---|
| Reactive Species | human, bovine, dog, guinea pig, porcine, rabbit |
|---|
| Isotype | n/a |
|---|
| Format | affinity purified |
|---|
| Size | 50ug |
|---|
| Concentration | n/a |
|---|
| Applications | WB |
|---|
| Reviews / Ratings | If you have used this antibody, please help fellow researchers by submitting reviews to pAbmAbs and antYbuddY. |
|---|
| Description | Rabbit Polyclonal Anti-C11orf53 Antibody |
|---|
| Immunogen | The immunogen for Anti-C11orf53 Antibody: synthetic peptide directed towards the middle region of human C11orf53. Synthetic peptide located within the following region: SIAQHRGSSWGSSLAGAQSYSLHALEDLHHTPGYPTPPPYPFTPFMTVSN |
|---|
| Other Names | chromosome 11 open reading frame 53 |
|---|
| Gene, Accession # | C11orf53, Accession: NM_198498 |
|---|
| Catalog # | TA333364 |
|---|
| Price | |
|---|
| Order / More Info | C11orf53 Antibody from ORIGENE TECHNOLOGIES |
|---|
| Product Specific References | n/a |
|---|