| Edit |   |
|---|
| Antigenic Specificity | A830039H10RIK |
|---|
| Clone | polyclonal |
|---|
| Host Species | Rabbit |
|---|
| Reactive Species | human |
|---|
| Isotype | n/a |
|---|
| Format | affinity purified |
|---|
| Size | 100ug |
|---|
| Concentration | n/a |
|---|
| Applications | WB |
|---|
| Reviews / Ratings | If you have used this antibody, please help fellow researchers by submitting reviews to pAbmAbs and antYbuddY. |
|---|
| Description | Rabbit polyclonal anti-A830039H10RIK antibody |
|---|
| Immunogen | The immunogen for anti-A830039H10RIK antibody: synthetic peptide corresponding to a region of Mouse. Synthetic peptide located within the following region: EIMEEAIAMVMSGKMSVSKAQGIYGVPHSTLEYKVKERSGTLKTPPKKKL |
|---|
| Other Names | MLR1, ligand dependent nuclear receptor corepressor-like |
|---|
| Gene, Accession # | Lcorl, Accession: NM_172153 |
|---|
| Catalog # | TA329595 |
|---|
| Price | |
|---|
| Order / More Info | A830039H10RIK Antibody from ORIGENE TECHNOLOGIES |
|---|
| Product Specific References | n/a |
|---|