| Edit |   |
| Antigenic Specificity | NOSIP - N-terminal region |
| Clone | polyclonal |
| Host Species | Rabbit |
| Reactive Species | bovine, dog, guinea pig, human, mouse, rat, zebrafish |
| Isotype | n/a |
| Format | affinity purified |
| Size | 50ug |
| Concentration | n/a |
| Applications | WB |
| Reviews / Ratings | If you have used this antibody, please help fellow researchers by submitting reviews to pAbmAbs and antYbuddY. |
| Description | Rabbit Polyclonal Anti-NOSIP Antibody - N-terminal region |
| Immunogen | The immunogen for anti-NOSIP antibody: synthetic peptide directed towards the N terminal of human NOSIP. Synthetic peptide located within the following region: LSRDAVKDFDCCCLSLQPCHDPVVTPDGYLYEREAILEYILHQKKEIARQ |
| Other Names | nitric oxide synthase interacting protein |
| Gene, Accession # | NOSIP, Accession: NM_015953 |
| Catalog # | TA345092 |
| Price | |
| Order / More Info | NOSIP - N-terminal region Antibody from ORIGENE TECHNOLOGIES |
| Product Specific References | n/a |