| Edit |   |
| Antigenic Specificity | UFSP1 |
| Clone | polyclonal |
| Host Species | Rabbit |
| Reactive Species | human, horse, bovine, rat, guinea pig |
| Isotype | n/a |
| Format | affinity purified |
| Size | 50ug |
| Concentration | n/a |
| Applications | WB |
| Reviews / Ratings | If you have used this antibody, please help fellow researchers by submitting reviews to pAbmAbs and antYbuddY. |
| Description | Rabbit Polyclonal Anti-UFSP1 Antibody |
| Immunogen | The immunogen for anti-UFSP1 antibody is: synthetic peptide directed towards the C-terminal region of Human UFSP1. Synthetic peptide located within the following region: DPHYWGTPKSPSELQAAGWVGWQEVSAAFDPNSFYNLCLTSLSSQQQQRT |
| Other Names | UFSP, UFM1-specific peptidase 1 (non-functional) |
| Gene, Accession # | UFSP1, Accession: NM_001015072 |
| Catalog # | TA334949 |
| Price | |
| Order / More Info | UFSP1 Antibody from ORIGENE TECHNOLOGIES |
| Product Specific References | n/a |