| Edit |   |
|---|
| Antigenic Specificity | DNAJC12 - middle region |
|---|
| Clone | polyclonal |
|---|
| Host Species | Rabbit |
|---|
| Reactive Species | mouse; human |
|---|
| Isotype | n/a |
|---|
| Format | affinity purified |
|---|
| Size | 50ug |
|---|
| Concentration | n/a |
|---|
| Applications | WB |
|---|
| Reviews / Ratings | If you have used this antibody, please help fellow researchers by submitting reviews to pAbmAbs and antYbuddY. |
|---|
| Description | Rabbit Polyclonal Anti-DNAJC12 Antibody - middle region |
|---|
| Immunogen | The immunogen for Anti-Dnajc12 antibody is synthetic peptide directed towards the middle region of Mouse Dnajc12. Synthetic peptide located within the following region: LAEFKIRALECHPDKHPENSKAVETFQKLQKAKEILCNAESRARYDHWRR |
|---|
| Other Names | JDP1, DnaJ (Hsp40) homolog, subfamily C, member 12 |
|---|
| Gene, Accession # | DJC12, Accession: NM_021800 |
|---|
| Catalog # | TA344721 |
|---|
| Price | |
|---|
| Order / More Info | DNAJC12 - middle region Antibody from ORIGENE TECHNOLOGIES |
|---|
| Product Specific References | n/a |
|---|