| Edit |   |
|---|
| Antigenic Specificity | TNIP3 |
|---|
| Clone | polyclonal |
|---|
| Host Species | Rabbit |
|---|
| Reactive Species | human |
|---|
| Isotype | n/a |
|---|
| Format | affinity purified |
|---|
| Size | 50ug |
|---|
| Concentration | n/a |
|---|
| Applications | WB |
|---|
| Reviews / Ratings | If you have used this antibody, please help fellow researchers by submitting reviews to pAbmAbs and antYbuddY. |
|---|
| Description | Rabbit Polyclonal Anti-TNIP3 Antibody |
|---|
| Immunogen | The immunogen for anti-TNIP3 antibody is: synthetic peptide directed towards the N-terminal region of Human TNIP3. Synthetic peptide located within the following region: YERKVAELKTKLDAAERFLSTREKDPHQRQRKDDRQREDDRQRDLTRDRL |
|---|
| Other Names | ABIN3, LIND, TNFAIP3 interacting protein 3 |
|---|
| Gene, Accession # | TNIP3, Accession: NM_001128843 |
|---|
| Catalog # | TA338308 |
|---|
| Price | |
|---|
| Order / More Info | TNIP3 Antibody from ORIGENE TECHNOLOGIES |
|---|
| Product Specific References | n/a |
|---|