| Edit |   |
|---|
| Antigenic Specificity | PILRA |
|---|
| Clone | polyclonal |
|---|
| Host Species | Rabbit |
|---|
| Reactive Species | human |
|---|
| Isotype | n/a |
|---|
| Format | affinity purified |
|---|
| Size | 50ug |
|---|
| Concentration | n/a |
|---|
| Applications | WB |
|---|
| Reviews / Ratings | If you have used this antibody, please help fellow researchers by submitting reviews to pAbmAbs and antYbuddY. |
|---|
| Description | Rabbit Polyclonal Anti-PILRA Antibody |
|---|
| Immunogen | The immunogen for anti-PILRA antibody: synthetic peptide directed towards the N terminal of human PILRA. Synthetic peptide located within the following region: IPFSFYYPWELATAPDVRISWRRGHFHRQSFYSTRPPSIHKDYVNRLFLN |
|---|
| Other Names | FDF03, paired immunoglobin-like type 2 receptor alpha |
|---|
| Gene, Accession # | PILRA, Accession: NM_178273 |
|---|
| Catalog # | TA341919 |
|---|
| Price | |
|---|
| Order / More Info | PILRA Antibody from ORIGENE TECHNOLOGIES |
|---|
| Product Specific References | n/a |
|---|