| Edit |   |
| Antigenic Specificity | TRIM49 - middle region |
| Clone | polyclonal |
| Host Species | Rabbit |
| Reactive Species | human |
| Isotype | n/a |
| Format | affinity purified |
| Size | 50ug |
| Concentration | n/a |
| Applications | WB |
| Reviews / Ratings | If you have used this antibody, please help fellow researchers by submitting reviews to pAbmAbs and antYbuddY. |
| Description | Rabbit Polyclonal Anti-TRIM49 Antibody - middle region |
| Immunogen | The immunogen for anti-TRIM49 antibody: synthetic peptide directed towards the middle region of human TRIM49. Synthetic peptide located within the following region: NMYRKEKNQNEKIDGKAGLFLLGCVKNDIQCSLFTTSPLMLQYIPKPTSR |
| Other Names | RNF18, TRIM49A, TRIM49L2, tripartite motif containing 49 |
| Gene, Accession # | TRI49, Accession: NM_020358 |
| Catalog # | TA344473 |
| Price | |
| Order / More Info | TRIM49 - middle region Antibody from ORIGENE TECHNOLOGIES |
| Product Specific References | n/a |