| Edit |   |
|---|
| Antigenic Specificity | CCDC107 |
|---|
| Clone | polyclonal |
|---|
| Host Species | Rabbit |
|---|
| Reactive Species | human, rat, mouse, dog, horse |
|---|
| Isotype | n/a |
|---|
| Format | affinity purified |
|---|
| Size | 50ug |
|---|
| Concentration | n/a |
|---|
| Applications | WB |
|---|
| Reviews / Ratings | If you have used this antibody, please help fellow researchers by submitting reviews to pAbmAbs and antYbuddY. |
|---|
| Description | Rabbit Polyclonal Anti-CCDC107 Antibody |
|---|
| Immunogen | The immunogen for anti-CCDC107 antibody is: synthetic peptide directed towards the N-terminal region of Human CCDC107. Synthetic peptide located within the following region: PPLKDQRERTRAGSLPLGALYTAAVAAFVLYKCLQGKDETAVLHEEASKQ |
|---|
| Other Names | PSEC0222, coiled-coil domain containing 107 |
|---|
| Gene, Accession # | CCDC107, Accession: NM_174923 |
|---|
| Catalog # | TA334807 |
|---|
| Price | |
|---|
| Order / More Info | CCDC107 Antibody from ORIGENE TECHNOLOGIES |
|---|
| Product Specific References | n/a |
|---|