| Edit |   |
|---|
| Antigenic Specificity | UPF3A |
|---|
| Clone | polyclonal |
|---|
| Host Species | Rabbit |
|---|
| Reactive Species | human |
|---|
| Isotype | n/a |
|---|
| Format | affinity purified |
|---|
| Size | 50ug |
|---|
| Concentration | n/a |
|---|
| Applications | WB |
|---|
| Reviews / Ratings | If you have used this antibody, please help fellow researchers by submitting reviews to pAbmAbs and antYbuddY. |
|---|
| Description | Rabbit Polyclonal Anti-UPF3A Antibody |
|---|
| Immunogen | The immunogen for anti-UPF3A antibody: synthetic peptide directed towards the middle region of human UPF3A. Synthetic peptide located within the following region: QRYHVDDGRRHRAHHEPERLSRRSEDEQRWGKGPGQDRGKKGSQDSGAPG |
|---|
| Other Names | HUPF3A, RENT3A, UPF3, UPF3 regulator of nonsense transcripts homolog A (yeast) |
|---|
| Gene, Accession # | REN3A, Accession: NM_023011 |
|---|
| Catalog # | TA343923 |
|---|
| Price | |
|---|
| Order / More Info | UPF3A Antibody from ORIGENE TECHNOLOGIES |
|---|
| Product Specific References | n/a |
|---|