| Edit |   |
|---|
| Antigenic Specificity | KH Domain Containing, RNA Binding, Signal Transduction Associated 1 (KHDRBS1) (N-Term) |
|---|
| Clone | polyclonal |
|---|
| Host Species | Rabbit |
|---|
| Reactive Species | human |
|---|
| Isotype | n/a |
|---|
| Format | affinity purified |
|---|
| Size | 50 µg |
|---|
| Concentration | n/a |
|---|
| Applications | Western Blotting (WB) |
|---|
| Reviews / Ratings | If you have used this antibody, please help fellow researchers by submitting reviews to pAbmAbs and antYbuddY. |
|---|
| Description | KHDRBS1 recruited and tyrosine phosphorylated by several receptor systems, for example the T-cell, leptin and insulin receptors. Once phosphorylated, KHDRBS1 functions as an adapter protein in signal transduction cascades by binding to SH2 and SH3 domain-containing proteins. KHDRBS1 play a role in G2-M progression in the cell cycle. It represses CBP-dependent transcriptional activation apparently by competing with other nuclear factors for binding to CBP. KHDRBS1 also acts as a putative regulator of mRNA stability and/or translation rates and mediates mRNA nuclear export. |
|---|
| Immunogen | KHDRBS1 antibody was raised using the N terminal of KHDRBS1 corresponding to a region with amino acids LPELMAEKDSLDPSFTHAMQLLTAEIEKIQKGDSKKDDEENYLDLFSHKN |
|---|
| Other Names | fj90g10|khdrbs1|p62|wu:fa18g12|wu:fa56c01|wu:fc91b01|wu:fj90g10|zgc:113899|KHDRBS1|Sam68|p68|P62|A170|OSIL|PDB3|ZIP3|p60|p62B |
|---|
| Gene, Accession # | Gene ID: 10657 |
|---|
| Catalog # | ABIN634247 |
|---|
| Price | |
|---|
| Order / More Info | KH Domain Containing, RNA Binding, Signal Transduction Associated 1 (KHDRBS1) (N-Term) Antibody from ANTIBODIES-ONLINE GmbH |
|---|
| Product Specific References | n/a |
|---|