| 产品详情 |
| Edit |   |
|---|
| Antigenic Specificity | Dynein, Light Chain, LC8-Type 1 (DYNLL1) (N-Term) |
|---|
| Clone | polyclonal |
|---|
| Host Species | Rabbit |
|---|
| Reactive Species | human, mouse, rat, Drosophila |
|---|
| Isotype | n/a |
|---|
| Format | affinity purified |
|---|
| Size | 50 µg |
|---|
| Concentration | n/a |
|---|
| Applications | Western Blotting (WB) |
|---|
| Reviews / Ratings | If you have used this antibody, please help fellow researchers by submitting reviews to pAbmAbs and antYbuddY. |
|---|
| Description | Cytoplasmic dyneins are large enzyme complexes with a molecular mass of about 1,200 kDa. They contain two force-producing heads formed primarily from dynein heavy chains, and stalks linking the heads to a basal domain, which contains a varying number of accessory intermediate chains. The complex is involved in intracellular transport and motility. DYNLL1 is a light chain and exists as part of this complex but also physically interacts with and inhibits the activity of neuronal nitric oxide synthase. Binding of this protein destabilizes the neuronal nitric oxide synthase dimer, a conformation necessary for activity, and it may regulate numerous biologic processes through its effects on nitric oxide synthase activity. |
|---|
| Immunogen | DYNLL1 antibody was raised using the N terminal of DYNLL1 corresponding to a region with amino acids MCDRKAVIKNADMSEEMQQDSVECATQALEKYNIEKDIAAHIKKEFDKKY |
|---|
| Other Names | lc8|dlc1|dlc8|lc8a|dncl1|dnclc1|dynll1a|MGC68763|pin|hdlc1|MGC89636|LC8|rhogap7|ARHGAP7|Dlc-1|STARD12|DLC-1|StARD12|A730069N07Rik|Arhgap7|HP|dlc-1|RhoGAP|DLC1|F56|Dlc8|Dnclc1|Pin|8kDLC|DLC8|DNCL1|DNCLC1|LC8a|PIN|dynll1|dynll1b|DYNLL1|CDLC2|dynll2|wu:fd56c09|zgc:73406 |
|---|
| Gene, Accession # | Gene ID: 8655,56455,58945 |
|---|
| Catalog # | ABIN631146 |
|---|
| Price | |
|---|
| Order / More Info | Dynein, Light Chain, LC8-Type 1 (DYNLL1) (N-Term) Antibody from ANTIBODIES-ONLINE GmbH |
|---|
| Product Specific References | n/a |
|---|
| 产品资料 |
|
|