| 产品详情 |
| Edit |   |
|---|
| Antigenic Specificity | P Glycoprotein/ABCB1 |
|---|
| Clone | polyclonal |
|---|
| Host Species | Rabbit |
|---|
| Reactive Species | human, mouse, rat |
|---|
| Isotype | n/a |
|---|
| Format | immunogen affinity purified |
|---|
| Size | 100ug (sample available) |
|---|
| Concentration | 500ug/ml. |
|---|
| Applications | IHC |
|---|
| Reviews / Ratings | If you have used this antibody, please help fellow researchers by submitting reviews to pAbmAbs and antYbuddY. |
|---|
| Description | Rabbit IgG polyclonal antibody for Multidrug resistance protein 1(ABCB1) detection. Tested with IHC-P, IHC-F in Human;Mouse;Rat. No cross reactivity with other proteins. P-GP, also called ABCB1 or PGY1, is a glycoprotein that in humans is encoded by the ABCB1 gene. It is mapped to 7q21.12. P-GP is a well-characterized ABC-transporter (which transports a wide variety of substrates across extra- and intracellular membranes) of the MDR/TAP subfamily. It is an important protein of the cell membrane that pumps many foreign substances out of cells. More formally, it is an ATP-dependent drug efflux pump with broad substrate specificity. P-GP is an ATP-dependent drug efflux pump forxenobiotic compounds with broad substrate specificity. It is responsible for decreased drug accumulation in multidrug-resistant cells and often mediates the development of resistance to anticancer drugs. This protein also functions as a transporter in the blood-brain barrier. |
|---|
| Immunogen | A synthetic peptide corresponding to a sequence in the middle region of human P Glycoprotein(621-650aa IYFKLVTMQTAGNEVELENAADESKSEIDA), different from the related rat sequence by twelve amino acids. |
|---|
| Other Names | Multidrug resistance protein 1;3.6.3.44;ATP-binding cassette sub-family B member 1;P-glycoprotein 1;CD243;ABCB1;MDR1, PGY1; |
|---|
| Gene, Accession # | 1853, UniProt: P08183 |
|---|
| Catalog # | RP1034 |
|---|
| Price | |
|---|
| Order / More Info | P Glycoprotein/ABCB1 Antibody from BOSTER BIO |
|---|
| Product Specific References | n/a |
|---|
| 产品资料 |
|
|