| Edit |   |
| Antigenic Specificity | MGC20983 |
| Clone | polyclonal |
| Host Species | Rabbit |
| Reactive Species | human |
| Isotype | n/a |
| Format | affinity purified |
| Size | 0.05 mg |
| Concentration | 1 mg/ml |
| Applications | Western Blot (WB) |
| Reviews / Ratings | If you have used this antibody, please help fellow researchers by submitting reviews to pAbmAbs and antYbuddY. |
| Description | MGC20983 antibody. Specificity: MGC20983 antibody was raised against the middle region of Mgc20983 |
| Immunogen | MGC20983 antibody was raised using the middle region of Mgc20983 corresponding to a region with amino acids IALPLATSKDKFFDEESEEEDNEVVTRASLKIRSQKLIESHKKHRRSRRS |
| Other Names | MGC20983; MGC20983; MGC20983; FLJ31801; MGC-20983; MGC 20983, |
| Gene, Accession # | MGC20983 |
| Catalog # | MBS5301219 |
| Price | |
| Order / More Info | MGC20983 Antibody from MYBIOSOURCE INC. |
| Product Specific References | n/a |