| Edit |   |
|---|
| Antigenic Specificity | MGC26647 |
|---|
| Clone | polyclonal |
|---|
| Host Species | Rabbit |
|---|
| Reactive Species | human |
|---|
| Isotype | n/a |
|---|
| Format | affinity purified |
|---|
| Size | 0.05 mg |
|---|
| Concentration | 1 mg/ml |
|---|
| Applications | Western Blot (WB) |
|---|
| Reviews / Ratings | If you have used this antibody, please help fellow researchers by submitting reviews to pAbmAbs and antYbuddY. |
|---|
| Description | MGC26647 antibody. Specificity: MGC26647 antibody was raised against the N terminal of MGC26647 |
|---|
| Immunogen | MGC26647 antibody was raised using the N terminal of MGC26647 corresponding to a region with amino acids EEKQRLHLKKFLLDRMFLVAKIQANVERKDVADYYEQMFQSVLKHHLGEA |
|---|
| Other Names | MGC26647; MGC26647; Hypothetical Protein Mgc26647; MGC-26647; MGC 26647; MGC26647, |
|---|
| Gene, Accession # | MGC26647 |
|---|
| Catalog # | MBS5301047 |
|---|
| Price | |
|---|
| Order / More Info | MGC26647 Antibody from MYBIOSOURCE INC. |
|---|
| Product Specific References | n/a |
|---|