| Edit |   |
|---|
| Antigenic Specificity | MGC42174 |
|---|
| Clone | polyclonal |
|---|
| Host Species | Rabbit |
|---|
| Reactive Species | human |
|---|
| Isotype | n/a |
|---|
| Format | Protein A purified |
|---|
| Size | 0.1 mg |
|---|
| Concentration | 1 mg/ml |
|---|
| Applications | Western Blot (WB), Immunohistochemistry (IHC) |
|---|
| Reviews / Ratings | If you have used this antibody, please help fellow researchers by submitting reviews to pAbmAbs and antYbuddY. |
|---|
| Description | MGC42174 antibody. Specificity: MGC42174 antibody was raised against the N terminal Of Mgc42174 |
|---|
| Immunogen | MGC42174 antibody was raised using the N terminal Of Mgc42174 corresponding to a region with amino acids MSHPDYRMNLRPLGTPRGVSAVAGPHDIGASPGDKKSKNRSTRGKKKSIF |
|---|
| Other Names | MGC42174; MGC42174; MGC-42174; MGC 42174; MGC42174, |
|---|
| Gene, Accession # | MGC42174 |
|---|
| Catalog # | MBS5300633 |
|---|
| Price | |
|---|
| Order / More Info | MGC42174 Antibody from MYBIOSOURCE INC. |
|---|
| Product Specific References | n/a |
|---|