| Edit |   |
|---|
| Antigenic Specificity | MGC50722 |
|---|
| Clone | polyclonal |
|---|
| Host Species | Rabbit |
|---|
| Reactive Species | human |
|---|
| Isotype | n/a |
|---|
| Format | affinity purified |
|---|
| Size | 0.05 mg |
|---|
| Concentration | 1 mg/ml |
|---|
| Applications | Western Blot (WB) |
|---|
| Reviews / Ratings | If you have used this antibody, please help fellow researchers by submitting reviews to pAbmAbs and antYbuddY. |
|---|
| Description | MGC50722 antibody. Specificity: MGC50722 antibody was raised against the N terminal of MGC50722 |
|---|
| Immunogen | MGC50722 antibody was raised using the N terminal of MGC50722 corresponding to a region with amino acids DPPWAAPHVVGSDDLKEPGPWGKACSLPMWSTGPEARDGDSSVSSGRLSC |
|---|
| Other Names | MGC50722 protein, partial; MGC50722 protein; uncharacterized protein LOC399693; MGC50722 protein, MGC50722; MGC50722 |
|---|
| Gene, Accession # | MGC50722, Gene ID: 399693, NCBI: AAH31926.1 |
|---|
| Catalog # | MBS838995 |
|---|
| Price | |
|---|
| Order / More Info | MGC50722 Antibody from MYBIOSOURCE INC. |
|---|
| Product Specific References | n/a |
|---|