| Edit |   |
| Antigenic Specificity | MGC70863 |
| Clone | polyclonal |
| Host Species | Rabbit |
| Reactive Species | human |
| Isotype | n/a |
| Format | affinity purified |
| Size | 0.05 mg |
| Concentration | 1 mg/ml |
| Applications | Western Blot (WB) |
| Reviews / Ratings | If you have used this antibody, please help fellow researchers by submitting reviews to pAbmAbs and antYbuddY. |
| Description | MGC70863 antibody. Specificity: MGC70863 antibody was raised against the N terminal of MGC70863 |
| Immunogen | MGC70863 antibody was raised using the N terminal of MGC70863 corresponding to a region with amino acids MSLTFRRPKTLRLRRQPRYPRKSTPRRNKLGHYAIIKFPLATESAVKKIE |
| Other Names | MGC70863; MGC70863; MGC 70863; MGC70863; MGC-70863; Similar To Rpl23Ap7 Protein, |
| Gene, Accession # | MGC70863 |
| Catalog # | MBS5300107 |
| Price | |
| Order / More Info | MGC70863 Antibody from MYBIOSOURCE INC. |
| Product Specific References | n/a |