| Edit |   |
|---|
| Antigenic Specificity | A Kinase (PRKA) Anchor Protein 1 (AKAP1) |
|---|
| Clone | polyclonal |
|---|
| Host Species | Rabbit |
|---|
| Reactive Species | human |
|---|
| Isotype | n/a |
|---|
| Format | affinity purified |
|---|
| Size | 50 µg |
|---|
| Concentration | n/a |
|---|
| Applications | Western Blotting (WB) |
|---|
| Reviews / Ratings | If you have used this antibody, please help fellow researchers by submitting reviews to pAbmAbs and antYbuddY. |
|---|
| Description | The A-kinase anchor proteins (AKAPs) are a group of structurally diverse proteins, which have the common function of binding to the regulatory subunit of protein kinase A (PKA) and confining the holoenzyme to discrete locations within the cell. |
|---|
| Immunogen | AKAP1 antibody was raised using a synthetic peptide corresponding to a region with amino acids VPFSNGVLKGELSDLGAEDGWTMDAEADHSGVAAPPPGKRGTLITRCPGF |
|---|
| Other Names | AKAP1|akap1|fa08b04|wu:fa08b04|AKAP|AKAP121|AKAP149|AKAP84|D-AKAP1|PPP1R43|PRKA1|SAKAP84|TDRD17|Akap|C76494|C81186|DAKAP1|S-AKAP84|Akap84 |
|---|
| Gene, Accession # | Gene ID: 8165 |
|---|
| Catalog # | ABIN633600 |
|---|
| Price | |
|---|
| Order / More Info | A Kinase (PRKA) Anchor Protein 1 (AKAP1) Antibody from ANTIBODIES-ONLINE GmbH |
|---|
| Product Specific References | n/a |
|---|