Edit |   |
Antigenic Specificity | Tankyrase, TRF1-Interacting Ankyrin-Related ADP-Ribose Polymerase (TNKS) (Middle Region) |
Clone | polyclonal |
Host Species | Rabbit |
Reactive Species | human, mouse |
Isotype | n/a |
Format | affinity purified |
Size | 50 µg |
Concentration | n/a |
Applications | Western Blotting (WB) |
Reviews / Ratings | If you have used this antibody, please help fellow researchers by submitting reviews to pAbmAbs and antYbuddY. |
Description | TNKS may regulate vesicle trafficking and modulate the subcellular distribution of SLC2A4/GLUT4-vesicles. It has PARP activity and can modify TERF1, and thereby contribute to the regulation of telomere length. |
Immunogen | TNKS antibody was raised using the middle region of TNKS corresponding to a region with amino acids LIKGVERLLGGQQGTNPYLTFHCVNQGTILLDLAPEDKEYQSVEEEMQST |
Other Names | wu:fe02c12|ARTD5|PARP-5a|PARP5A|PARPL|TIN1|TINF1|TNKS1|pART5|4930554K12Rik|AI662855|C86528|D130072O21Rik|TANK1|mTNKS1|tankyrase-1 |
Gene, Accession # | Gene ID: 8658,21951 |
Catalog # | ABIN631422 |
Price | |
Order / More Info | Tankyrase, TRF1-Interacting Ankyrin-Related ADP-Ribose Polymerase (TNKS) (Middle Region) Antibody from ANTIBODIES-ONLINE GmbH |
Product Specific References | n/a |