| 产品详情 |
| Edit |   |
|---|
| Product Name | Cystathionine beta-Synthase, Recombinant, Human, aa1-413, His-SUMO-Tag (CBS) |
|---|
| Description | Purity ~90% (SDS-PAGE). Only known pyridoxal phosphate-dependent enzyme that contains he. Important regulator of hydrogen sulfide, especially in the brain, utilizing cysteine instead of serine to catalyze the formation of hydrogen sulfide. Hydrogen sulfide is a gastratransmitter with signaling and cytoprotective effects such as acting as a neuromodulator in the brain to protect neurons against hypoxic injury. Source: Recombinant protein corresponding to aa1-413 from human Cystathionine beta-synthase, fused to His-SUMO-Tag at N-terminal, expressed in E. coli. Molecular Weight: ~61.4kD AA Sequence MPSETPQAEVGPTGCPHRSGPHSAKGSLEKGSPEDKEAKEPLWIRPDAPSRCTWQLGRPASESPHHHTAPAKSPKILPDILKKIGDTPMVRINKIGKKFGLKCELLAKCEFFNAGGSVKDRISLRMIEDAERDGTLKPGDTIIEPTSGNTGIGLALAAAVRGYRCIIVMPEKMSSEKVDVLRALGAEIVRTPTNARFDSPESHVGVAWRLKNEIPNSHILDQYRNASNPLAHYDTTADEILQQCDGKLDMLVASVGTGGTITGIARKLKEKCPGCRIIGVDPEGSILAEPEELNQTEQTTYEVEGIGYDFIPTVLDRTVVDKWFKSNDEEAFTFARMLIAQEGLLCGGSAGSTVAVAVKAAQELQEGQRCVVILPDSVRNYMTKFLSDRWMLQKGFLKEEDLTEKKPWWWHLR: |
|---|
| Size | 10ug, 50ug, 100ug |
|---|
| Concentration | n/a |
|---|
| Applications | n/a |
|---|
| Other Names | Beta-thionase, Serine sulfhydrase |
|---|
| Gene, Accession, CAS # | SwissProt: P35520 |
|---|
| Catalog # | 372966 |
|---|
| Price | |
|---|
| Order / More Info | Cystathionine beta-Synthase, Recombinant, Human, aa1-413, His-SUMO-Tag (CBS) from UNITED STATES BIOLOGICAL |
|---|
| Product Specific References | n/a |
|---|
| 产品资料 |
|
|