| Edit |   |
|---|
| Antigenic Specificity | AarF Domain Containing Kinase 3 (ADCK3) |
|---|
| Clone | polyclonal |
|---|
| Host Species | Rabbit |
|---|
| Reactive Species | human, mouse, rat |
|---|
| Isotype | n/a |
|---|
| Format | affinity purified |
|---|
| Size | 50 µg |
|---|
| Concentration | n/a |
|---|
| Applications | Western Blotting (WB) |
|---|
| Reviews / Ratings | If you have used this antibody, please help fellow researchers by submitting reviews to pAbmAbs and antYbuddY. |
|---|
| Description | CABC1 is a mitochondrial protein similar to yeast ABC1, which functions in an electron-transferring membrane protein complex in the respiratory chain. It is not related to the family of ABC transporter proteins. Expression of this gene is induced by the tumor suppressor p53 and in response to DNA damage, and inhibiting its expression partially suppresses p53-induced apoptosis. |
|---|
| Immunogen | CABC1 antibody was raised using a synthetic peptide corresponding to a region with amino acids FANPRDSFSAMGFQRRFFHQDQSPVGGLTAEDIEKARQAKARPENKQHKQ |
|---|
| Other Names | ARCA2|CABC1|COQ10D4|COQ8|SCAR9|4632432J16Rik|AI462003|Cabc1|mKIAA0451|cabc1 |
|---|
| Gene, Accession # | Gene ID: 56997,67426,360887 |
|---|
| Catalog # | ABIN631069 |
|---|
| Price | |
|---|
| Order / More Info | AarF Domain Containing Kinase 3 (ADCK3) Antibody from ANTIBODIES-ONLINE GmbH |
|---|
| Product Specific References | n/a |
|---|