Edit |   |
Antigenic Specificity | AARS (N-Term) |
Clone | polyclonal |
Host Species | Rabbit |
Reactive Species | human |
Isotype | n/a |
Format | affinity purified |
Size | 50 µg |
Concentration | n/a |
Applications | Western Blotting (WB) |
Reviews / Ratings | If you have used this antibody, please help fellow researchers by submitting reviews to pAbmAbs and antYbuddY. |
Description | The human alanyl-tRNA synthetase (AARS) belongs to a family of tRNA synthases, of the class II enzymes. Class II tRNA synthases evolved early in evolution and are highly conserved. This is reflected by the fact that 498 of the 968-residue polypeptide human AARS shares 41% identity witht the E.coli protein. |
Immunogen | AARS antibody was raised using the N terminal of AARS corresponding to a region with amino acids DSTLTASEIRQRFIDFFKRNEHTYVHSSATIPLDDPTLLFANAGMNQFKP |
Other Names | im:7146712|si:ch211-223o1.6|wu:fc48h07|zgc:113920|CMT2N|AI316495|C76919|sti |
Gene, Accession # | Gene ID: 16 |
Catalog # | ABIN633270 |
Price | |
Order / More Info | AARS (N-Term) Antibody from ANTIBODIES-ONLINE GmbH |
Product Specific References | n/a |