| Edit |   |
|---|
| Antigenic Specificity | Abhydrolase Domain Containing 5 (ABHD5) (N-Term) |
|---|
| Clone | polyclonal |
|---|
| Host Species | Rabbit |
|---|
| Reactive Species | human, mouse, rat |
|---|
| Isotype | n/a |
|---|
| Format | purified |
|---|
| Size | 100 µg |
|---|
| Concentration | n/a |
|---|
| Applications | Western Blotting (WB) |
|---|
| Reviews / Ratings | If you have used this antibody, please help fellow researchers by submitting reviews to pAbmAbs and antYbuddY. |
|---|
| Description | ABHD5 belongs to a large family of proteins defined by an alpha/beta hydrolase fold, and contains three sequence motifs that correspond to a catalytic triad found in the esterase/lipase/thioesterase subfamily. It differs from other members of this subfamily in that its putative catalytic triad contains an asparagine instead of the serine residue. Mutations in ABHD5 gene have been associated with Chanarin-Dorfman syndrome, a triglyceride storage disease with impaired long-chain fatty acid oxidation. |
|---|
| Immunogen | ABHD5 antibody was raised using the N terminal of ABHD5 corresponding to a region with amino acids NRPVYAFDLLGFGRSSRPRFDSDAEEVENQFVESIEEWRCALGLDKMILL |
|---|
| Other Names | ABHD5|cds|cgi58|iecn2|ncie2|abhd5|CDS|CGI58|IECN2|NCIE2|1300003D03Rik|2010002J10Rik|CGI-58|IECN5 |
|---|
| Gene, Accession # | Gene ID: 51099,67469,316122 |
|---|
| Catalog # | ABIN629839 |
|---|
| Price | |
|---|
| Order / More Info | Abhydrolase Domain Containing 5 (ABHD5) (N-Term) Antibody from ANTIBODIES-ONLINE GmbH |
|---|
| Product Specific References | n/a |
|---|