| 产品详情 |
| Edit |   |
|---|
| Antigenic Specificity | Cleavage and Polyadenylation Specific Factor 4, 30kDa (CPSF4) (C-Term) |
|---|
| Clone | polyclonal |
|---|
| Host Species | Rabbit |
|---|
| Reactive Species | human, mouse, rat, dog |
|---|
| Isotype | n/a |
|---|
| Format | affinity purified |
|---|
| Size | 50 µg |
|---|
| Concentration | n/a |
|---|
| Applications | Western Blotting (WB) |
|---|
| Reviews / Ratings | If you have used this antibody, please help fellow researchers by submitting reviews to pAbmAbs and antYbuddY. |
|---|
| Description | Inhibition of the nuclear export of poly(A)-containing mRNAs caused by the influenza A virus NS1 protein requires its effector domain. The NS1 effector domain functionally interacts with the cellular 30 kDa subunit of cleavage and polyadenylation specific factor 4, an essential component of the 3' end processing machinery of cellular pre-mRNAs. In influenza virus-infected cells, the NS1 protein is physically associated with cleavage and polyadenylation specific factor 4, 30 kDa subunit. Binding of the NS1 protein to the 30 kDa protein in vitro prevents CPSF binding to the RNA substrate and inhibits 3' end cleavage and polyadenylation of host pre-mRNAs. Thus the NS1 protein selectively inhibits the nuclear export of cellular, and not viral, mRNAs. |
|---|
| Immunogen | CPSF4 antibody was raised using the C terminal of CPSF4 corresponding to a region with amino acids SLIQLTSQNSSPNQQRTPQVIGVMQSQNSSAGNRGPRPLEQVTCYKCGEK |
|---|
| Other Names | cpsf30|nar|neb1|30kDa|C79664|CPSF30|NAR|NEB1 |
|---|
| Gene, Accession # | Gene ID: 10898,489859,54188,304277 |
|---|
| Catalog # | ABIN633192 |
|---|
| Price | |
|---|
| Order / More Info | Cleavage and Polyadenylation Specific Factor 4, 30kDa (CPSF4) (C-Term) Antibody from ANTIBODIES-ONLINE GmbH |
|---|
| Product Specific References | n/a |
|---|
| 产品资料 |
|
|