| Edit |   |
|---|
| Antigenic Specificity | Cleavage and Polyadenylation Specific Factor 6, 68kDa (CPSF6) (Middle Region) |
|---|
| Clone | polyclonal |
|---|
| Host Species | Rabbit |
|---|
| Reactive Species | human, mouse, rat, dog |
|---|
| Isotype | n/a |
|---|
| Format | purified |
|---|
| Size | 100 µg |
|---|
| Concentration | n/a |
|---|
| Applications | Western Blotting (WB),Immunohistochemistry (IHC) |
|---|
| Reviews / Ratings | If you have used this antibody, please help fellow researchers by submitting reviews to pAbmAbs and antYbuddY. |
|---|
| Description | CPSF6 is one subunit of a cleavage factor required for 3' RNA cleavage and polyadenylation processing. The interaction of the protein with the RNA is one of the earliest steps in the assembly of the 3' end processing complex and facilitates the recruitement of other processing factors. The cleavage factor complex is composed of four polypeptides. |
|---|
| Immunogen | CPSF6 antibody was raised using the middle region of CPSF6 corresponding to a region with amino acids PPLAGPPNRGDRPPPPVLFPGQPFGQPPLGPLPPGPPPPVPGYGPPPGPP |
|---|
| Other Names | CPSF6|wu:fa22f12|zgc:85819|4733401N12Rik|AI256641|CFIM|CFIM68|HPBRII-4|HPBRII-7 |
|---|
| Gene, Accession # | Gene ID: 11052,474441,432508,299811 |
|---|
| Catalog # | ABIN630020 |
|---|
| Price | |
|---|
| Order / More Info | Cleavage and Polyadenylation Specific Factor 6, 68kDa (CPSF6) (Middle Region) Antibody from ANTIBODIES-ONLINE GmbH |
|---|
| Product Specific References | n/a |
|---|