| Edit |   |
|---|
| Antigenic Specificity | AAMDC |
|---|
| Clone | polyclonal |
|---|
| Host Species | Rabbit |
|---|
| Reactive Species | human (antigen sequence identity: mouse 89%, rat 89%) |
|---|
| Isotype | n/a |
|---|
| Format | antigen affinity purified |
|---|
| Size | 100 µl |
|---|
| Concentration | n/a |
|---|
| Applications | ICC-IF, IHC, WB. Validation of protein expression in IHC by comparing independent antibodies targeting different epitopes of the protein., Recombinant expression validation in WB using target protein overexpression. |
|---|
| Reviews / Ratings | If you have used this antibody, please help fellow researchers by submitting reviews to pAbmAbs and antYbuddY. |
|---|
| Description | Rabbit anti-human AAMDC polyclonal antibody. |
|---|
| Immunogen | Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence: EIASLSWGQMKVKGSNTTYKDCKVWPGGSRTWDWRETGTEHSPGVQPADVKEVVEK |
|---|
| Other Names | adipogenesis associated, Mth938 domain containing, C11orf67, CK067, FLJ21035, PTD015 |
|---|
| Gene, Accession # | Gene ID: 28971, UniProt: Q9H7C9, ENSG00000087884 |
|---|
| Catalog # | HPA037918 |
|---|
| Price | |
|---|
| Order / More Info | AAMDC Antibody from ATLAS ANTIBODIES AB |
|---|
| Product Specific References | n/a |
|---|