| Edit |   |
|---|
| Antigenic Specificity | CCDC74A |
|---|
| Clone | polyclonal |
|---|
| Host Species | Rabbit |
|---|
| Reactive Species | human |
|---|
| Isotype | n/a |
|---|
| Format | affinity purified |
|---|
| Size | 0.05 mg |
|---|
| Concentration | 1 mg/ml |
|---|
| Applications | Western Blot (WB) |
|---|
| Reviews / Ratings | If you have used this antibody, please help fellow researchers by submitting reviews to pAbmAbs and antYbuddY. |
|---|
| Description | CCDC74A antibody. Specificity: CCDC74A antibody was raised against the middle region of CCDC74A |
|---|
| Immunogen | CCDC74A antibody was raised using the middle region of CCDC74A corresponding to a region with amino acids FPKVSTKSLSKKCLSPPVAERAILPALKQTPKNNFAERQKRLQAMQKRRL |
|---|
| Other Names | coiled-coil domain-containing protein 74A isoform 4; Coiled-coil domain-containing protein 74A; coiled-coil domain-containing protein 74A; coiled-coil domain containing 74A, CCDC74A; CCDC74A |
|---|
| Gene, Accession # | CCDC74A, Gene ID: 90557, NCBI: NP_001245235.1 |
|---|
| Catalog # | MBS5302505 |
|---|
| Price | |
|---|
| Order / More Info | CCDC74A Antibody from MYBIOSOURCE INC. |
|---|
| Product Specific References | n/a |
|---|