| Edit |   |
|---|
| Antigenic Specificity | SAT2 |
|---|
| Clone | polyclonal |
|---|
| Host Species | Rabbit |
|---|
| Reactive Species | human (antigen sequence identity: mouse 87%, rat 87%) |
|---|
| Isotype | n/a |
|---|
| Format | antigen affinity purified |
|---|
| Size | 100 µl |
|---|
| Concentration | n/a |
|---|
| Applications | IHC. Orthogonal validation of protein expression using IHC by comparison to RNA-seq data of corresponding target in high and low expression tissues., Validation of protein expression in IHC by comparing independent antibodies targeting different epitopes of the protein. |
|---|
| Reviews / Ratings | If you have used this antibody, please help fellow researchers by submitting reviews to pAbmAbs and antYbuddY. |
|---|
| Description | Rabbit anti-human SAT2 polyclonal antibody. |
|---|
| Immunogen | Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence: LRLIRELAEFEKLSDQVKISEEALRADGFGDNPFYHCLV |
|---|
| Other Names | spermidine/spermine N1-acetyltransferase family member 2, SSAT2 |
|---|
| Gene, Accession # | Gene ID: 112483, UniProt: Q96F10, ENSG00000141504 |
|---|
| Catalog # | HPA057096 |
|---|
| Price | |
|---|
| Order / More Info | SAT2 Antibody from ATLAS ANTIBODIES AB |
|---|
| Product Specific References | n/a |
|---|