Edit |   |
Antigenic Specificity | Keratin 23 (KRT23) |
Clone | polyclonal |
Host Species | Rabbit |
Reactive Species | human |
Isotype | n/a |
Format | affinity purified |
Size | 50 µg |
Concentration | n/a |
Applications | Western Blotting (WB) |
Reviews / Ratings | If you have used this antibody, please help fellow researchers by submitting reviews to pAbmAbs and antYbuddY. |
Description | KRT23 is a member of the keratin family. The keratins are intermediate filament proteins responsible for the structural integrity of epithelial cells and are subdivided into cytokeratins and hair keratins. The type I cytokeratins consist of acidic proteins which are arranged in pairs of heterotypic keratin chains. |
Immunogen | Cytokeratin 23 antibody was raised using a synthetic peptide corresponding to a region with amino acids IKTHLEKEITTYRRLLEGESEGTREESKSSMKVSATPKIKAITQETINGR |
Other Names | CK23|Haik1|K23|Krt1-23|HAIK1 |
Gene, Accession # | Gene ID: 25984 |
Catalog # | ABIN631521 |
Price | |
Order / More Info | Keratin 23 (KRT23) Antibody from ANTIBODIES-ONLINE GmbH |
Product Specific References | n/a |