| 产品详情 |
| Edit |   |
|---|
| Antigenic Specificity | Pea3/ETV4 |
|---|
| Clone | polyclonal |
|---|
| Host Species | Rabbit |
|---|
| Reactive Species | human, rat |
|---|
| Isotype | n/a |
|---|
| Format | immunogen affinity purified |
|---|
| Size | 100ug (sample available) |
|---|
| Concentration | 500ug/ml. |
|---|
| Applications | WB |
|---|
| Reviews / Ratings | If you have used this antibody, please help fellow researchers by submitting reviews to pAbmAbs and antYbuddY. |
|---|
| Description | Rabbit IgG polyclonal Picoband™ antibody for ETS translocation variant 4(ETV4) detection. Tested with WB in Human;Rat. No cross reactivity with other proteins. ETS translocation variant 4 (ETV4), also known as polyoma enhancer activator 3 (PEA3), or E1AF, is a member of the PEA3 subfamily of Ets transcription factors. It is mapped to 17q21.31. E1AF can activate the promoters of various matrix metalloproteinases, genes whose expression is associated with tumor cell invasion and metastasis, by 10 to 20 fold. Pea3 is detected in cells of epithelial and fibroblastic origin. It is also a transcriptional activator that binds to the enhancer of the adenovirus E1A gene. |
|---|
| Immunogen | A synthetic peptide corresponding to a sequence at the N-terminus of human Pea3 (1-41aa MERRMKAGYLDQQVPYTFSSKSPGNGSLREALIGPLGKLMD), different from the related mouse sequence by seven amino acids. |
|---|
| Other Names | ETS translocation variant 4;Adenovirus E1A enhancer-binding protein;E1A-F;Polyomavirus enhancer activator 3 homolog;Protein PEA3;ETV4;E1AF, PEA3; |
|---|
| Gene, Accession # | ETV4, UniProt: P43268 |
|---|
| Catalog # | PB9699 |
|---|
| Price | |
|---|
| Order / More Info | Pea3/ETV4 Antibody from BOSTER BIO |
|---|
| Product Specific References | n/a |
|---|
| 产品资料 |
|
|