| Edit |   |
|---|
| Antigenic Specificity | DNASE1L1 |
|---|
| Clone | polyclonal |
|---|
| Host Species | Rabbit |
|---|
| Reactive Species | human (antigen sequence identity: mouse 77%, rat 75%) |
|---|
| Isotype | n/a |
|---|
| Format | antigen affinity purified |
|---|
| Size | 100 µl |
|---|
| Concentration | n/a |
|---|
| Applications | IHC |
|---|
| Reviews / Ratings | If you have used this antibody, please help fellow researchers by submitting reviews to pAbmAbs and antYbuddY. |
|---|
| Description | Rabbit anti-human DNASE1L1 polyclonal antibody. |
|---|
| Immunogen | Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence: GFHWVIADGEDTTVRASTHCTYDRVVLHGERCRSLLHTAAAFDFPTSFQLTEEEALNISDH |
|---|
| Other Names | deoxyribonuclease I-like 1, DNAS1L1, DNASEX, DNL1L, XIB |
|---|
| Gene, Accession # | Gene ID: 1774, UniProt: P49184, ENSG00000013563 |
|---|
| Catalog # | HPA072635 |
|---|
| Price | |
|---|
| Order / More Info | DNASE1L1 Antibody from ATLAS ANTIBODIES AB |
|---|
| Product Specific References | n/a |
|---|