| Edit |   |
|---|
| Antigenic Specificity | Glutathione Reductase (GSR) (N-Term) |
|---|
| Clone | polyclonal |
|---|
| Host Species | Rabbit |
|---|
| Reactive Species | human, mouse |
|---|
| Isotype | n/a |
|---|
| Format | affinity purified |
|---|
| Size | 50 µg |
|---|
| Concentration | n/a |
|---|
| Applications | Western Blotting (WB) |
|---|
| Reviews / Ratings | If you have used this antibody, please help fellow researchers by submitting reviews to pAbmAbs and antYbuddY. |
|---|
| Description | GSR belongs to the class-I pyridine nucleotide-disulfide oxidoreductase family. It maintains high levels of reduced glutathione in the cytosol. Both glutathione and glutathione reductase are inducible by D3T, and that upregulation of GSH biosynthesis underlies D3T-mediated cytoprotection against ROS/RNS-elicited injury to human vascular smooth muscle cells. |
|---|
| Immunogen | GSR antibody was raised using the N terminal of GSR corresponding to a region with amino acids PTIEVSGKKYTAPHILIATGGMPSTPHESQIPGASLGITSDGFFQLEELP |
|---|
| Other Names | GR|DDBDRAFT_0168952|DDBDRAFT_0231410|DDB_0168952|DDB_0231410|2151|CG2151|DTR|Dm-TrxR|DmTR|DmTrx|DmTrxR|DmTrxR-1|Dmel\\CG2151|Gr|Trx|TrxR|TrxR-1|Trxr1|anon-WO03040301.185|anon-WO03040301.187|dTrxR|dmtrxr-1|gr|l(1)G0154|l(1)G0379|l(1)G0477|l(1)G0481|trxr-1|ATGR2|EMB2360|glutathione reductase|AI325518|D8Ertd238e|Gr-1|Gr1|gor1|GSR |
|---|
| Gene, Accession # | Gene ID: 2936,109408 |
|---|
| Catalog # | ABIN633841 |
|---|
| Price | |
|---|
| Order / More Info | Glutathione Reductase (GSR) (N-Term) Antibody from ANTIBODIES-ONLINE GmbH |
|---|
| Product Specific References | n/a |
|---|