| Edit |   |
|---|
| Antigenic Specificity | Opticin |
|---|
| Clone | polyclonal |
|---|
| Host Species | Rabbit |
|---|
| Reactive Species | human |
|---|
| Isotype | n/a |
|---|
| Format | affinity purified |
|---|
| Size | 0.05 mg |
|---|
| Concentration | 1 mg/ml |
|---|
| Applications | Western Blot (WB) |
|---|
| Reviews / Ratings | If you have used this antibody, please help fellow researchers by submitting reviews to pAbmAbs and antYbuddY. |
|---|
| Description | Opticin antibody. Specificity: Opticin antibody was raised against the C terminal of OPTC |
|---|
| Immunogen | Opticin antibody was raised using the C terminal of OPTC corresponding to a region with amino acids LSDNLLDSIPGPLPLSLRSVHLQNNLIETMQRDVFCDPEEHKHTRRQLED |
|---|
| Other Names | opticin; Opticin; opticin; opticin; Oculoglycan, OPTC; OPTC; OPT; OPT |
|---|
| Gene, Accession # | Gene ID: 26254, NCBI: NP_055174.1 |
|---|
| Catalog # | MBS5300086 |
|---|
| Price | |
|---|
| Order / More Info | Opticin Antibody from MYBIOSOURCE INC. |
|---|
| Product Specific References | n/a |
|---|