| 产品详情 |
| Edit |   |
|---|
| Antigenic Specificity | Olfactory Receptor, Family 2, Subfamily W, Member 5 (OR2W5) (Middle Region) |
|---|
| Clone | polyclonal |
|---|
| Host Species | Rabbit |
|---|
| Reactive Species | human |
|---|
| Isotype | n/a |
|---|
| Format | affinity purified |
|---|
| Size | 50 µg |
|---|
| Concentration | n/a |
|---|
| Applications | Western Blotting (WB) |
|---|
| Reviews / Ratings | If you have used this antibody, please help fellow researchers by submitting reviews to pAbmAbs and antYbuddY. |
|---|
| Description | Olfactory receptors interact with odorant molecules in the nose, to initiate a neuronal response that triggers the perception of a smell. The olfactory receptor proteins are members of a large family of G-protein-coupled receptors (GPCR) arising from single coding-exon genes. Olfactory receptors share a 7-transmembrane domain structure with many neurotransmitter and hormone receptors and are responsible for the recognition and G protein-mediated transduction of odorant signals. The olfactory receptor gene family is the largest in the genome. The nomenclature assigned to the olfactory receptor genes and proteins for this organism is independent of other organisms. |
|---|
| Immunogen | OR2 W5 antibody was raised using the middle region of OR2 5 corresponding to a region with amino acids SGEVPDSLLHHRHSQHQPPHLHFEEQGCEGDHEETSGVGERGWGASTRGT |
|---|
| Other Names | OR2W5P|OST722 |
|---|
| Gene, Accession # | Gene ID: 441932 |
|---|
| Catalog # | ABIN635348 |
|---|
| Price | |
|---|
| Order / More Info | Olfactory Receptor, Family 2, Subfamily W, Member 5 (OR2W5) (Middle Region) Antibody from ANTIBODIES-ONLINE GmbH |
|---|
| Product Specific References | n/a |
|---|
| 产品资料 |
|
|