| Edit |   |
|---|
| Antigenic Specificity | RANBP1 |
|---|
| Clone | polyclonal |
|---|
| Host Species | Rabbit |
|---|
| Reactive Species | human (antigen sequence identity: mouse 93%, rat 90%) |
|---|
| Isotype | n/a |
|---|
| Format | antigen affinity purified |
|---|
| Size | 100 µl |
|---|
| Concentration | n/a |
|---|
| Applications | ICC-IF, IHC. Orthogonal validation of protein expression using IHC by comparison to RNA-seq data of corresponding target in high and low expression tissues. |
|---|
| Reviews / Ratings | If you have used this antibody, please help fellow researchers by submitting reviews to pAbmAbs and antYbuddY. |
|---|
| Description | Rabbit anti-human RANBP1 polyclonal antibody. |
|---|
| Immunogen | Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence: AKDTHEDHDTSTENTDESNHDPQFEPIVSL |
|---|
| Other Names | RAN binding protein 1, HTF9A |
|---|
| Gene, Accession # | Gene ID: 5902, UniProt: P43487, ENSG00000099901 |
|---|
| Catalog # | HPA065931 |
|---|
| Price | |
|---|
| Order / More Info | RANBP1 Antibody from ATLAS ANTIBODIES AB |
|---|
| Product Specific References | n/a |
|---|