| 产品详情 |
| Edit |   |
|---|
| Antigenic Specificity | SCARB1 |
|---|
| Clone | n/a |
|---|
| Host Species | n/a |
|---|
| Reactive Species | mouse, rat |
|---|
| Isotype | n/a |
|---|
| Format | immunogen affinity purified |
|---|
| Size | 0.1 mg |
|---|
| Concentration | n/a |
|---|
| Applications | Western Blot (WB) |
|---|
| Reviews / Ratings | If you have used this antibody, please help fellow researchers by submitting reviews to pAbmAbs and antYbuddY. |
|---|
| Description | Anti-SCARB1 Antibody |
|---|
| Immunogen | A synthetic peptide corresponding to a sequence at the C-terminus of mouse SCARB1 (478-509aa KKGSQDKEAIQAYSESLMSPAAKGTVLQEAKL), different from the related rat sequence by one amino acid.Ig Type: Rabbit IgG |
|---|
| Other Names | scavenger receptor class B member 1 isoform 2; Scavenger receptor class B member 1; scavenger receptor class B member 1; scavenger receptor class B, member 1; SR-BI, Scarb1; Scarb1; CD36; Cla1; SRBI; Srb1; Cla-1; Hdlq1; SR-B1; SR-BI; Cd36l1; Chohd1; Hlb398; mSR-BI; AI120173; D5Ertd460e; Srb1; SRB1 |
|---|
| Gene, Accession # | SCARB1, Gene ID: 20778, NCBI: NP_001192011.1, UniProt: Q61009 |
|---|
| Catalog # | MBS178336 |
|---|
| Price | |
|---|
| Order / More Info | SCARB1 Antibody from MYBIOSOURCE INC. |
|---|
| Product Specific References | 1. Entrez Gene: SCARB1 Scavenger receptor class B, member 1. 2. Acton S, Rigotti A, Landschulz KT, Xu S, Hobbs HH, Krieger M (January 1996). Identification of scavenger receptor SR-BI as a high density lipoprotein receptor.Science 271 (5248): 518-20. 3. Duggan AE, Marie RS, Callard IP (April 2002). Expression of SR-BI (Scavenger Receptor Class B Type I) in turtle (Chrysemys picta) tissues and other nonmammalian vertebrates. J. Exp. Zool.292 (5): 430-4. |
|---|
| 产品资料 |
|
|