| 产品详情 |
| Edit |   |
|---|
| Antigenic Specificity | AMACR |
|---|
| Clone | polyclonal |
|---|
| Host Species | Rabbit |
|---|
| Reactive Species | human, mouse, rat |
|---|
| Isotype | n/a |
|---|
| Format | immunogen affinity purified |
|---|
| Size | 0.1 mg |
|---|
| Concentration | n/a |
|---|
| Applications | Western Blot (WB) |
|---|
| Reviews / Ratings | If you have used this antibody, please help fellow researchers by submitting reviews to pAbmAbs and antYbuddY. |
|---|
| Description | Anti-AMACR Antibody. Reactivity: Human, Mouse, Rat No cross reactivity with other proteins. |
|---|
| Immunogen | A synthetic peptide corresponding to a sequence in the middle region of human AMACR (208-246aa RGQNMLDGGAPFYTTYRTADGEFMAVGAIEPQFYELLIK), different from the related mouse and rat sequences by four amino acids. |
|---|
| Other Names | alpha-methylacyl-CoA racemase isoform 3; Alpha-methylacyl-CoA racemase; alpha-methylacyl-CoA racemase; alpha-methylacyl-CoA racemase; 2-methylacyl-CoA racemase, AMACR; AMACR; RM; RACE; CBAS4; AMACRD |
|---|
| Gene, Accession # | AMACR, Gene ID: 23600, NCBI: NP_001161067.1, UniProt: Q9UHK6 |
|---|
| Catalog # | MBS178483 |
|---|
| Price | |
|---|
| Order / More Info | AMACR Antibody from MYBIOSOURCE INC. |
|---|
| Product Specific References | 1. Amery, L., Fransen, M., De Nys, K., Mannaerts, G. P., Van Veldhoven, P. P. Mitochondrial and peroxisomal targeting of 2-methylacyl-CoA racemase in humans. J. Lipid Res. 41: 1752-1759, 2000. 2. Clarke, C. E., Alger, S., Preece, M. A., Burdon, M. A., Chavda, S., Denis, S., Ferdinandusse, S., Wanders, R. J. A. Tremor and deep white matter changes in alpha-methylacyl-CoA racemase deficiency. Neurology 63: 188-189, 2004. 3. Dick, D., Horvath, R., Chinnery, P. F. AMACR mutations cause late-on |
|---|
| 产品资料 |
|
|