| 产品详情 |
| Edit |   |
|---|
| Antigenic Specificity | MMP8 |
|---|
| Clone | n/a |
|---|
| Host Species | n/a |
|---|
| Reactive Species | mouse, rat |
|---|
| Isotype | n/a |
|---|
| Format | immunogen affinity purified |
|---|
| Size | 0.1 mg |
|---|
| Concentration | n/a |
|---|
| Applications | Western Blot (WB), Immunohistochemistry (IHC) Paraffin, ELISA (EIA) |
|---|
| Reviews / Ratings | If you have used this antibody, please help fellow researchers by submitting reviews to pAbmAbs and antYbuddY. |
|---|
| Description | Anti-MMP8 Antibody |
|---|
| Immunogen | A synthetic peptide corresponding to a sequence at the N-terminus of mouse MMP8 (120-157aa HTPQLSRAEVKTAIEKAFHVWSVASPLTFTEILQGEAD), different from the related human sequence by eleven amino acids, and from the related rat sequence by nine amino acids.Ig Type: Rabbit IgG |
|---|
| Other Names | neutrophil collagenase preproprotein; Neutrophil collagenase; neutrophil collagenase; matrix metallopeptidase 8; Collagenase 2; Matrix metalloproteinase-8; MMP-8, Mmp8; Mmp8; BB138268; MMP-8 |
|---|
| Gene, Accession # | MMP8, Gene ID: 17394, NCBI: NP_032637.3, UniProt: O70138 |
|---|
| Catalog # | MBS178181 |
|---|
| Price | |
|---|
| Order / More Info | MMP8 Antibody from MYBIOSOURCE INC. |
|---|
| Product Specific References | 1. Balbin, M.; Fueyo, A.; Tester, A. M.; Pendas, A. M.; Pitiot, A. S.; Astudillo, A.; Overall, C. M.; Shapiro, S. D.; Lopez-Otin, C. : Loss of collagenase-2 confers increased skin tumor susceptibility to male mice. Nature Genet. 35: 252-257, 2003. 2. Devarajan, P.; Mookhtiar, K.; Van Wart, H.; Berliner, N. : Structure and expression of the cDNA encoding human neutrophil collagenase. Blood 77: 2731-2738, 1991. 3. Hasty, K. A.; Pourmotabbed, T. F.; Goldberg, G. I.; Thompson, J. P.; Spinella, D. G. |
|---|
| 产品资料 |
|
|