| Edit |   |
|---|
| Antigenic Specificity | MMP9 |
|---|
| Clone | n/a |
|---|
| Host Species | n/a |
|---|
| Reactive Species | mouse, rat |
|---|
| Isotype | n/a |
|---|
| Format | immunogen affinity purified |
|---|
| Size | 0.1 mg |
|---|
| Concentration | n/a |
|---|
| Applications | Western Blot (WB), Immunohistochemistry (IHC) Paraffin, ELISA (EIA) |
|---|
| Reviews / Ratings | If you have used this antibody, please help fellow researchers by submitting reviews to pAbmAbs and antYbuddY. |
|---|
| Description | Anti-MMP9 Antibody |
|---|
| Immunogen | A synthetic peptide corresponding to a sequence at the C-terminus of mouse MMP9 (641-672aa KALLFSKGRVWRFDLKSQKVDPQSVIRVDKEF), different from the related human sequence by thirteen amino acids, and from the related rat sequence by eight amino acids.Ig Type: Rabbit IgG |
|---|
| Other Names | matrix metalloproteinase-9 preproprotein; Matrix metalloproteinase-9; matrix metalloproteinase-9; matrix metallopeptidase 9; 92 kDa gelatinase; 92 kDa type IV collagenase; Gelatinase B; GELB, Mmp9; Mmp9; Clg4b; Gel B; MMP-9; B/MMP9; AW743869; pro-MMP-9; Clg4b; MMP-9; GELB |
|---|
| Gene, Accession # | MMP9, Gene ID: 17395, NCBI: NP_038627.1, UniProt: P41245 |
|---|
| Catalog # | MBS178238 |
|---|
| Price | |
|---|
| Order / More Info | MMP9 Antibody from MYBIOSOURCE INC. |
|---|
| Product Specific References | 1. Template:, 92kDa type IV collagenase). 2. Yuichiro Hirose et al. (May 2008). A Functional Polymorphism in THBS2 that Affects Alternative Splicing and MMP Binding Is Associated with Lumbar-Disc Herniation. |
|---|