| 产品详情 |
| Edit |   |
|---|
| Antigenic Specificity | ASPH |
|---|
| Clone | n/a |
|---|
| Host Species | n/a |
|---|
| Reactive Species | human, mouse, rat |
|---|
| Isotype | n/a |
|---|
| Format | immunogen affinity purified |
|---|
| Size | 0.1 mg |
|---|
| Concentration | n/a |
|---|
| Applications | Western Blot (WB), Immunohistochemistry (IHC) Paraffin |
|---|
| Reviews / Ratings | If you have used this antibody, please help fellow researchers by submitting reviews to pAbmAbs and antYbuddY. |
|---|
| Description | Anti-ASPH Antibody |
|---|
| Immunogen | A synthetic peptide corresponding to a sequence at the C-terminus of human ASPH (726-758aa EVWQDASSFRLIFIVDVWHPELTPQQRRSLPAI), identical to the related mouse sequence.Ig Type: Rabbit IgG |
|---|
| Other Names | aspartyl/asparaginyl beta-hydroxylase isoform f; Aspartyl/asparaginyl beta-hydroxylase; aspartyl/asparaginyl beta-hydroxylase; aspartate beta-hydroxylase; Aspartate beta-hydroxylase; ASP beta-hydroxylase; Peptide-aspartate beta-dioxygenase, ASPH; ASPH; AAH; BAH; HAAH; JCTN; FDLAB; junctin; CASQ2BP1; BAH; ASP beta-hydroxylase |
|---|
| Gene, Accession # | ASPH, Gene ID: 444, NCBI: NP_001158222.1, UniProt: Q12797 |
|---|
| Catalog # | MBS177861 |
|---|
| Price | |
|---|
| Order / More Info | ASPH Antibody from MYBIOSOURCE INC. |
|---|
| Product Specific References | 1. Entrez Gene: ASPH aspartate beta-hydroxylase. 2. Korioth F, Gieffers C, Frey J (Feb 1995). Cloning and characterization of the human gene encoding aspartyl beta-hydroxylase. Gene 150 (2): 395-9. 3. Lim KY, Hong CS, Kim DH (Nov 2000). cDNA cloning and characterization of human cardiac junctin. Gene 255 (1): 35-42. |
|---|
| 产品资料 |
|
|