| 产品详情 |
| Edit |   |
|---|
| Product Name | Irf8, Recombinant, Mouse, aa1-424, His-SUMO-Tag (Interferon Regulatory Factor 8) |
|---|
| Description | Purity ~90% (SDS-PAGE). Specifically binds to the upstream regulatory region of type I IFN and IFN-inducible MHC class I genes (the interferon consensus sequence (ICS)). Plays a regulatory role in cells of the immune system. Involved in CD8+ dendritic cell differentiation by forming a complex with the BATF-JUNB heterodimer in immune cells, leading to recognition of AICE sequence (5'-TGAnTCA/GAAA-3'), an immune-specific regulatory element, followed by cooperative binding of BATF and IRF8 and activation of genes. Source: Recombinant protein corresponding to aa1-424 from mouse Irf8, fused to His-SUMO-Tag at N-terminal, expressed in E. coli. Molecular Weight: ~64.2kD AA Sequence MCDRNGGRRLRQWLIEQIDSSMYPGLIWENDEKTMFRIPWKHAGKQDYNQEVDASIFKAWAVFKGKFKEGDKAEPATWKTRLRCALNKSPDFEEVTDRSQLDISEPYKVYRIVPEEEQKCKLGVAPAGCMSEVPEMECGRSEIEELIKEPSVDEYMGMTKRSPSPPEACRSQILPDWWVQQPSAGLPLVTGYAAYDTHHSAFSQMVISFYYGGKLVGQATTTCLEGCRLSLSQPGLPKLYGPDGLEPVCFPTADTIPSERQRQVTRKLFGHLERGVLLHSNRKGVFVKRLCQGRVFCSGNAVVCKGRPNKLERDEVVQVFDTNQFIRELQQFYATQSRLP |
|---|
| Size | 10ug, 50ug, 100ug |
|---|
| Concentration | n/a |
|---|
| Applications | n/a |
|---|
| Other Names | Interferon consensus sequence-binding protein, ICSBP |
|---|
| Gene, Accession, CAS # | SwissProt: P23611 |
|---|
| Catalog # | 373863 |
|---|
| Price | |
|---|
| Order / More Info | Irf8, Recombinant, Mouse, aa1-424, His-SUMO-Tag (Interferon Regulatory Factor 8) from UNITED STATES BIOLOGICAL |
|---|
| Product Specific References | n/a |
|---|
| 产品资料 |
|
|