Edit |   |
Antigenic Specificity | Keratin 18 (KRT18) (C-Term) |
Clone | polyclonal |
Host Species | Rabbit |
Reactive Species | human |
Isotype | n/a |
Format | purified |
Size | 100 µg |
Concentration | n/a |
Applications | Western Blotting (WB),Immunohistochemistry (IHC) |
Reviews / Ratings | If you have used this antibody, please help fellow researchers by submitting reviews to pAbmAbs and antYbuddY. |
Description | KRT18 (Keratin 18) is type I intermediate filament chain. Keratin 18, together with its filament partner keratin 8, are perhaps the most commonly found members of the intermediate filament gene family. They are expressed in single layer epithelial tissues of the body. Mutations in this gene have been linked to cryptogenic cirrhosis. |
Immunogen | Cytokeratin 18 antibody was raised using the C terminal of KRT18 corresponding to a region with amino acids ALLNIKVKLEAEIATYRRLLEDGEDFNLGDALDSSNSMQTIQKTTTRRIV |
Other Names | krt18|MGC64569|MGC75922|KRT18|CYK18|K18|CK18|Krt1-18|DreK18|cb83|dapk1|sb:cb83|wu:fa13f02|wu:fb36b04|krtt1c6|zgc:66015 |
Gene, Accession # | Gene ID: 3875 |
Catalog # | ABIN629978 |
Price | |
Order / More Info | Keratin 18 (KRT18) (C-Term) Antibody from ANTIBODIES-ONLINE GmbH |
Product Specific References | n/a |