Edit |   |
Antigenic Specificity | Keratin 75 (KRT75) (Middle Region) |
Clone | polyclonal |
Host Species | Rabbit |
Reactive Species | human |
Isotype | n/a |
Format | affinity purified |
Size | 50 µg |
Concentration | n/a |
Applications | Western Blotting (WB) |
Reviews / Ratings | If you have used this antibody, please help fellow researchers by submitting reviews to pAbmAbs and antYbuddY. |
Description | This gene is a member of the type II keratin family clustered on the long arm of chromosome 12. Type I and type II keratins heteropolymerize to form intermediate-sized filaments in the cytoplasm of epithelial cells. |
Immunogen | Cytokeratin 75 antibody was raised using the middle region of KRT75 corresponding to a region with amino acids SFTTSGGHSLGAGLGGSGFSATSNRGLGGSGSSVKFVSTTSSSQKSYTH |
Other Names | KRT75|K6HF|KB18|PFB|4732468K03Rik|AA589387|K6hf|Krt2-6hf|Krtcap1|Kb18 |
Gene, Accession # | Gene ID: 9119 |
Catalog # | ABIN631612 |
Price | |
Order / More Info | Keratin 75 (KRT75) (Middle Region) Antibody from ANTIBODIES-ONLINE GmbH |
Product Specific References | n/a |